PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g034150.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 203aa    MW: 23390.8 Da    PI: 9.6308
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g034150.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.9e-1854107457
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         ++++++eq++ Le  F   + ++ +++++LA++lgL+ +qV vWFqN+Ra++k+
  Sopim03g034150.0.1  54 KRKLSQEQVNLLEHSFGDAHRLDMKTKAKLASELGLDLQQVAVWFQNKRARWKN 107
                         4589************************************************95 PP

2HD-ZIP_I/II103.12.3e-3353144293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         +kr+ls+eqv+lLE+sF   ++L+ + K++la+eLgl+ +qvavWFqn+RAR+k+k+lE +y++Lk++++    e++rLe++  +++e+l+
  Sopim03g034150.0.1  53 RKRKLSQEQVNLLEHSFGDAHRLDMKTKAKLASELGLDLQQVAVWFQNKRARWKNKKLEDEYSKLKSQHEITIIEKCRLETQILKMKEQLS 143
                         8***************************************************************************************998 PP

         HD-ZIP_I/II  93 e 93 
                         e
  Sopim03g034150.0.1 144 E 144
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.3748108IPR001356Homeobox domain
SMARTSM003892.5E-1551112IPR001356Homeobox domain
SuperFamilySSF466896.27E-1653116IPR009057Homeodomain-like
CDDcd000863.39E-1353109No hitNo description
PfamPF000464.7E-1554107IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.3E-1955115IPR009057Homeodomain-like
PRINTSPR000312.2E-57988IPR000047Helix-turn-helix motif
PROSITE patternPS00027083106IPR017970Homeobox, conserved site
PRINTSPR000312.2E-588104IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MTHHQLDDHQ MVMISQYHPG INTQLALDHQ GEVKPSRRRK KNKGETSNNG VVRKRKLSQE  60
QVNLLEHSFG DAHRLDMKTK AKLASELGLD LQQVAVWFQN KRARWKNKKL EDEYSKLKSQ  120
HEITIIEKCR LETQILKMKE QLSEAKKEIQ RLLLDTNCAR VSSNNNSPIT TSSSIISMEQ  180
PYILENFGME GILMDNNVYF GC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13654RRRKKNKGETSNNGVVRKR
23855RKKNKGETSNNGVVRKRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755151e-175HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004234617.11e-151PREDICTED: homeobox-leucine zipper protein ATHB-40-like isoform X2
SwissprotQ9ZU701e-61ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLK4BFT71e-151K4BFT7_SOLLC; Uncharacterized protein
STRINGSolyc03g034150.1.11e-150(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12892480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18550.11e-59homeobox protein 21